CYP46A1 monoclonal antibody (M02), clone 2B5
  • CYP46A1 monoclonal antibody (M02), clone 2B5

CYP46A1 monoclonal antibody (M02), clone 2B5

Ref: AB-H00010858-M02
CYP46A1 monoclonal antibody (M02), clone 2B5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CYP46A1.
Información adicional
Size 100 ug
Gene Name CYP46A1
Gene Alias CP46|CYP46
Gene Description cytochrome P450, family 46, subfamily A, polypeptide 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq TSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CYP46A1 (NP_006659, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10858
Clone Number 2B5
Iso type IgG1 Kappa

Enviar un mensaje


CYP46A1 monoclonal antibody (M02), clone 2B5

CYP46A1 monoclonal antibody (M02), clone 2B5