CD3EAP polyclonal antibody (A01)
  • CD3EAP polyclonal antibody (A01)

CD3EAP polyclonal antibody (A01)

Ref: AB-H00010849-A01
CD3EAP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CD3EAP.
Información adicional
Size 50 uL
Gene Name CD3EAP
Gene Alias ASE-1|CAST|MGC118851|PAF49
Gene Description CD3e molecule, epsilon associated protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq EEPQAGDAARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNGRHVPLSGSQIVKGKLAGKRHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD3EAP (NP_036231, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10849

Enviar un mensaje


CD3EAP polyclonal antibody (A01)

CD3EAP polyclonal antibody (A01)