PDE10A polyclonal antibody (A01)
  • PDE10A polyclonal antibody (A01)

PDE10A polyclonal antibody (A01)

Ref: AB-H00010846-A01
PDE10A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PDE10A.
Información adicional
Size 50 uL
Gene Name PDE10A
Gene Alias FLJ11894|FLJ25677|HSPDE10A
Gene Description phosphodiesterase 10A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNKELYSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDE10A (NP_006652, 242 a.a. ~ 333 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10846

Enviar un mensaje


PDE10A polyclonal antibody (A01)

PDE10A polyclonal antibody (A01)