TUBGCP2 purified MaxPab rabbit polyclonal antibody (D01P)
  • TUBGCP2 purified MaxPab rabbit polyclonal antibody (D01P)

TUBGCP2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010844-D01P
TUBGCP2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TUBGCP2 protein.
Información adicional
Size 100 ug
Gene Name TUBGCP2
Gene Alias GCP2|MGC138162|SPBC97|Spc97p
Gene Description tubulin, gamma complex associated protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSEFRIHHDVNELLSLLRVHGGDGAEVYIDLLQKNRTPYVTTTVSAHSAKVKIAEFSRTPEDFLKKYDELKSKNTRNLDPLVYLLSKLTEDKETLQYLQQNAKERAELAAAAVGSSTTSINVPAAASKISMQELEELRKQLGSVATGSTLQQSLELKRKMLRDKQNKKNSGQHLPIFPAWVYERPALIGDFLIGAGISTDTALPIGTLPLASQESAVVEDLLYVLVGVDGRYVSAQPLAGRQSRTFLVDPNLDLS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TUBGCP2 (NP_006650.1, 1 a.a. ~ 902 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10844

Enviar un mensaje


TUBGCP2 purified MaxPab rabbit polyclonal antibody (D01P)

TUBGCP2 purified MaxPab rabbit polyclonal antibody (D01P)