GJB6 polyclonal antibody (A01)
  • GJB6 polyclonal antibody (A01)

GJB6 polyclonal antibody (A01)

Ref: AB-H00010804-A01
GJB6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GJB6.
Información adicional
Size 50 uL
Gene Name GJB6
Gene Alias CX30|DFNA3|ED2|EDH|HED
Gene Description gap junction protein, beta 6, 30kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GDEQEDFVCNTLQPGCKNVCYDHFFPVSHIR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GJB6 (AAH38934, 45 a.a. ~ 75 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10804

Enviar un mensaje


GJB6 polyclonal antibody (A01)

GJB6 polyclonal antibody (A01)