SEPT9 monoclonal antibody (M01), clone 2C6
  • SEPT9 monoclonal antibody (M01), clone 2C6

SEPT9 monoclonal antibody (M01), clone 2C6

Ref: AB-H00010801-M01
SEPT9 monoclonal antibody (M01), clone 2C6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SEPT9.
Información adicional
Size 100 ug
Gene Name SEPT9
Gene Alias AF17q25|FLJ75490|KIAA0991|MSF|MSF1|NAPB|PNUTL4|SINT1|SeptD1
Gene Description septin 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PRRVQTPLLRATVASSTQKFQDLGVKNSEPSARHVDSLSQRSPKASLRRVELSGPKAAEPVSRRTELSIDISSKQVENAGAIGPSRFGLKRAEVLGHKTP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SEPT9 (AAH21192, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10801
Clone Number 2C6
Iso type IgG2a Kappa

Enviar un mensaje


SEPT9 monoclonal antibody (M01), clone 2C6

SEPT9 monoclonal antibody (M01), clone 2C6