Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
WDR4 MaxPab rabbit polyclonal antibody (D01)
Abnova
WDR4 MaxPab rabbit polyclonal antibody (D01)
Ref: AB-H00010785-D01
WDR4 MaxPab rabbit polyclonal antibody (D01)
Contáctenos
Información del producto
Rabbit polyclonal antibody raised against a full-length human WDR4 protein.
Información adicional
Size
100 uL
Gene Name
WDR4
Gene Alias
TRM82
Gene Description
WD repeat domain 4
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,IP,IF
Immunogen Prot. Seq
MAGSVGLALCGQTLVVRGGSRFLATSIASSDDDSLFIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFSKSGSYFALTDDSKRLILFRTKPWQCLSVRTVARRCTALTFIASEEKVLVADKSGDVYSFSVLEPHGCGRLELGHLSMLLDVAVSPDDRFILTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRISVVPTQPGLLLSSSGDGTLRLWEYRSGRQLHCCHLASLQELVDPQAPQKFAASRIAFWCQE
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
WDR4 (NP_061139.2, 1 a.a. ~ 412 a.a) full-length human protein.
Storage Buffer
No additive
Gene ID
10785
Enviar un mensaje
WDR4 MaxPab rabbit polyclonal antibody (D01)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*