ZNF274 monoclonal antibody (M04), clone 1D8
  • ZNF274 monoclonal antibody (M04), clone 1D8

ZNF274 monoclonal antibody (M04), clone 1D8

Ref: AB-H00010782-M04
ZNF274 monoclonal antibody (M04), clone 1D8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ZNF274.
Información adicional
Size 100 ug
Gene Name ZNF274
Gene Alias DKFZp686K08243|FLJ37843|HFB101|ZF2|ZKSCAN19
Gene Description zinc finger protein 274
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,ELISA,RNAi-Ab,IF
Immunogen Prot. Seq QKIDNPESQANSGALDTNQVLLHKIPPRKRLRKRDSQVKSMKHNSRVKIHQKSCERQKAKEGNGCRKTFSRSTKQITFIRIHKGSQVCRCSECGKIFRNPRYFSVHKKIHT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF274 (NP_598009, 420 a.a. ~ 530 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10782
Clone Number 1D8
Iso type IgG2a Kappa

Enviar un mensaje


ZNF274 monoclonal antibody (M04), clone 1D8

ZNF274 monoclonal antibody (M04), clone 1D8