ZNF274 polyclonal antibody (A01)
  • ZNF274 polyclonal antibody (A01)

ZNF274 polyclonal antibody (A01)

Ref: AB-H00010782-A01
ZNF274 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ZNF274.
Información adicional
Size 50 uL
Gene Name ZNF274
Gene Alias DKFZp686K08243|FLJ37843|HFB101|ZF2|ZKSCAN19
Gene Description zinc finger protein 274
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QKIDNPESQANSGALDTNQVLLHKIPPRKRLRKRDSQVKSMKHNSRVKIHQKSCERQKAKEGNGCRKTFSRSTKQITFIRIHKGSQVCRCSECGKIFRNPRYFSVHKKIHT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF274 (NP_598009, 420 a.a. ~ 530 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10782

Enviar un mensaje


ZNF274 polyclonal antibody (A01)

ZNF274 polyclonal antibody (A01)