POP4 polyclonal antibody (A01)
  • POP4 polyclonal antibody (A01)

POP4 polyclonal antibody (A01)

Ref: AB-H00010775-A01
POP4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant POP4.
Información adicional
Size 50 uL
Gene Name POP4
Gene Alias RPP29
Gene Description processing of precursor 4, ribonuclease P/MRP subunit (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TQPQMIQAKLLKADLHGAIISVTKSKCPSYVGITGILLQETKHIFKIITKEDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POP4 (NP_006618, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10775

Enviar un mensaje


POP4 polyclonal antibody (A01)

POP4 polyclonal antibody (A01)