PLK2 polyclonal antibody (A01)
  • PLK2 polyclonal antibody (A01)

PLK2 polyclonal antibody (A01)

Ref: AB-H00010769-A01
PLK2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PLK2.
Información adicional
Size 50 uL
Gene Name PLK2
Gene Alias SNK
Gene Description polo-like kinase 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DGGDLPSVTDIRRPRLYLLQWLKSDKALMMLFNDGTFQVNFYHDHTKIIICSQNEEYLLTYINEDRISTTFRLTTLLMSGCSSELKNRMEYALNMLLQRCN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLK2 (AAH13879, 585 a.a. ~ 685 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10769

Enviar un mensaje


PLK2 polyclonal antibody (A01)

PLK2 polyclonal antibody (A01)