HBS1L MaxPab rabbit polyclonal antibody (D01)
  • HBS1L MaxPab rabbit polyclonal antibody (D01)

HBS1L MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00010767-D01
HBS1L MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HBS1L protein.
Información adicional
Size 100 uL
Gene Name HBS1L
Gene Alias DKFZp686L13262|EF-1a|ERFS|HBS1|HSPC276
Gene Description HBS1-like (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MARHRNVRGYNYDEDFEDDDLYGQSVEDDYCISPSTAAQFIYSRRDKPSVEPVEEYDYEDLKESSNSVSNHQLSGFDQARLYSCLDHMREVLGDAVPDEILIEAVLKNKFDVQKALSGVLEQDRVQSLKDKNEATVSTGKIAKGKPVDSQTSRSESEIVPKVAKMTVSGKKQTMGFEVPGVSSEENGHSFHTPQKGPPIEDAIASSDVLETASKSANPPHTIQASEEQSSTPAPVKKSGKLRQQIDVKAELEKRQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HBS1L (NP_006611.1, 1 a.a. ~ 684 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 10767

Enviar un mensaje


HBS1L MaxPab rabbit polyclonal antibody (D01)

HBS1L MaxPab rabbit polyclonal antibody (D01)