NUP50 monoclonal antibody (M01), clone 4H7
  • NUP50 monoclonal antibody (M01), clone 4H7

NUP50 monoclonal antibody (M01), clone 4H7

Ref: AB-H00010762-M01
NUP50 monoclonal antibody (M01), clone 4H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NUP50.
Información adicional
Size 100 ug
Gene Name NUP50
Gene Alias MGC39961|NPAP60|NPAP60L
Gene Description nucleoporin 50kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTGKNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSEDADELHKILLEKKD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NUP50 (NP_705931.1, 342 a.a. ~ 439 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10762
Clone Number 4H7
Iso type IgG2b Kappa

Enviar un mensaje


NUP50 monoclonal antibody (M01), clone 4H7

NUP50 monoclonal antibody (M01), clone 4H7