TRAF3IP2 purified MaxPab mouse polyclonal antibody (B01P)
  • TRAF3IP2 purified MaxPab mouse polyclonal antibody (B01P)

TRAF3IP2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010758-B01P
TRAF3IP2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TRAF3IP2 protein.
Información adicional
Size 50 ug
Gene Name TRAF3IP2
Gene Alias ACT1|C6orf2|C6orf4|C6orf5|C6orf6|CIKS|DKFZp586G0522|MGC3581
Gene Description TRAF3 interacting protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLHNSSGDFSQAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCSAVSEPASESVVGALPAEHQFSFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSLGGSQEMVQRPQPHRNRAGLDLPTIDTGYDSQPQDVLGIRQLERPLPLTSVCYPQDLPRPLRSREFPQFEPQRYPACAQMLPPNL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRAF3IP2 (NP_679211.1, 1 a.a. ~ 565 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10758

Enviar un mensaje


TRAF3IP2 purified MaxPab mouse polyclonal antibody (B01P)

TRAF3IP2 purified MaxPab mouse polyclonal antibody (B01P)