CHL1 polyclonal antibody (A01)
  • CHL1 polyclonal antibody (A01)

CHL1 polyclonal antibody (A01)

Ref: AB-H00010752-A01
CHL1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CHL1.
Información adicional
Size 50 uL
Gene Name CHL1
Gene Alias CALL|FLJ44930|L1CAM2|MGC132578
Gene Description cell adhesion molecule with homology to L1CAM (close homolog of L1)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq EIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMSEEIEFIVPSVPKFPK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHL1 (NP_006605, 26 a.a. ~ 135 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10752

Enviar un mensaje


CHL1 polyclonal antibody (A01)

CHL1 polyclonal antibody (A01)