RAI1 monoclonal antibody (M01), clone 6H5
  • RAI1 monoclonal antibody (M01), clone 6H5

RAI1 monoclonal antibody (M01), clone 6H5

Ref: AB-H00010743-M01
RAI1 monoclonal antibody (M01), clone 6H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RAI1.
Información adicional
Size 100 ug
Gene Name RAI1
Gene Alias DKFZp434A139|KIAA1820|MGC12824|SMCR|SMS
Gene Description retinoic acid induced 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MQSFRERCGFHGKQQNYQQTSQETSRLENYRQPSQAGLSCDRQRLLAKDYYNPQPYPSYEGGAGTPSGTAAAVAADKYHRGSKALPTQQGLQGRPAFPGYG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAI1 (NP_109590.3, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10743
Clone Number 6H5
Iso type IgG2a Kappa

Enviar un mensaje


RAI1 monoclonal antibody (M01), clone 6H5

RAI1 monoclonal antibody (M01), clone 6H5