RBBP9 monoclonal antibody (M01), clone 2A11
  • RBBP9 monoclonal antibody (M01), clone 2A11

RBBP9 monoclonal antibody (M01), clone 2A11

Ref: AB-H00010741-M01
RBBP9 monoclonal antibody (M01), clone 2A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RBBP9.
Información adicional
Size 100 ug
Gene Name RBBP9
Gene Alias BOG|MGC9236|RBBP10
Gene Description retinoblastoma binding protein 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA,IF
Immunogen Prot. Seq THRVYAIVLVSAYTSDLGDENERASGYFTRPWQWEKIKANCPYIVQFGSTDDPFLPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELITVVKSLLKVP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RBBP9 (NP_006597, 87 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10741
Clone Number 2A11
Iso type IgG2a Kappa

Enviar un mensaje


RBBP9 monoclonal antibody (M01), clone 2A11

RBBP9 monoclonal antibody (M01), clone 2A11