Ver mas grande
STAG2 monoclonal antibody (M01), clone 3C6
AB-H00010735-M01
Producto nuevo
STAG2 monoclonal antibody (M01), clone 3C6
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | STAG2 |
| Gene Alias | DKFZp686P168|DKFZp781H1753|FLJ25871|SA-2|SA2|bA517O1.1 |
| Gene Description | stromal antigen 2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,IHC-P,ELISA,IF |
| Immunogen Prot. Seq | KRLRPEDSFMSVYPMQTEHHQTPLDYNRRGTSLMEDDEEPIVEDVMMSSEGRIEDLNEGMDFDTMDIDLPPSKNRRERTELKPDFFDPASIMDESVLGVSMF |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | STAG2 (NP_006594.3, 1130 a.a. ~ 1231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 10735 |
| Clone Number | 3C6 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant STAG2.