PLK4 monoclonal antibody (M01), clone 1C8
  • PLK4 monoclonal antibody (M01), clone 1C8

PLK4 monoclonal antibody (M01), clone 1C8

Ref: AB-H00010733-M01
PLK4 monoclonal antibody (M01), clone 1C8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PLK4.
Información adicional
Size 100 ug
Gene Name PLK4
Gene Alias SAK|STK18
Gene Description polo-like kinase 4 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MATCIGEKIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSILELYNYFEDSNYVYLVLEMCHNGEMNRYLKNRVKPFSE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLK4 (AAH36023, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10733
Clone Number 1C8
Iso type IgG1 Kappa

Enviar un mensaje


PLK4 monoclonal antibody (M01), clone 1C8

PLK4 monoclonal antibody (M01), clone 1C8