PTGES3 polyclonal antibody (A01)
  • PTGES3 polyclonal antibody (A01)

PTGES3 polyclonal antibody (A01)

Ref: AB-H00010728-A01
PTGES3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant PTGES3.
Información adicional
Size 50 uL
Gene Name PTGES3
Gene Alias P23|TEBP|cPGES
Gene Description prostaglandin E synthase 3 (cytosolic)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTGES3 (AAH03005, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10728

Enviar un mensaje


PTGES3 polyclonal antibody (A01)

PTGES3 polyclonal antibody (A01)