TBR1 polyclonal antibody (A01)
  • TBR1 polyclonal antibody (A01)

TBR1 polyclonal antibody (A01)

Ref: AB-H00010716-A01
TBR1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TBR1.
Información adicional
Size 50 uL
Gene Name TBR1
Gene Alias MGC141978|TES-56
Gene Description T-box, brain, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MQLEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFDGSAADRYLLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TBR1 (NP_006584, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10716

Enviar un mensaje


TBR1 polyclonal antibody (A01)

TBR1 polyclonal antibody (A01)