POLD3 polyclonal antibody (A01)
  • POLD3 polyclonal antibody (A01)

POLD3 polyclonal antibody (A01)

Ref: AB-H00010714-A01
POLD3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant POLD3.
Información adicional
Size 50 uL
Gene Name POLD3
Gene Alias KIAA0039|MGC119642|MGC119643|P66|P68
Gene Description polymerase (DNA-directed), delta 3, accessory subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PPLEPVPKTEPEPPSVKSSSGENKRKRKRVLKSKTYLDGEGCIVTEKVYESESCTDSEEELNMKTSSVHRPPAMTVKKEPREERKGPKKGTAALGKANRQVSITGFFQRK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POLD3 (NP_006582, 357 a.a. ~ 466 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10714

Enviar un mensaje


POLD3 polyclonal antibody (A01)

POLD3 polyclonal antibody (A01)