CORIN polyclonal antibody (A01)
  • CORIN polyclonal antibody (A01)

CORIN polyclonal antibody (A01)

Ref: AB-H00010699-A01
CORIN polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CORIN.
Información adicional
Size 50 uL
Gene Name CORIN
Gene Alias ATC2|CRN|Lrp4|MGC119742|TMPRSS10
Gene Description corin, serine peptidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq CKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CORIN (NP_006578, 616 a.a. ~ 715 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10699

Enviar un mensaje


CORIN polyclonal antibody (A01)

CORIN polyclonal antibody (A01)