CCT8 purified MaxPab mouse polyclonal antibody (B02P)
  • CCT8 purified MaxPab mouse polyclonal antibody (B02P)

CCT8 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00010694-B02P
CCT8 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CCT8 protein.
Información adicional
Size 50 ug
Gene Name CCT8
Gene Alias C21orf112|Cctq|D21S246|KIAA0002|PRED71
Gene Description chaperonin containing TCP1, subunit 8 (theta)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MALHVPKAPGFAQMLKEGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVSEVIEGYEIACRKAHEILPNLVCCSAKNLRDIDEVSSLLRTSIMSKQYGNEVFLAKLIAQACVSIFPDSGHFNVDNIRVCKILGSGISSSSVLHGMVFKKETEGDVTSVKDAKIAVYSCPFDGMITETKG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CCT8 (NP_006576.2, 1 a.a. ~ 548 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10694

Enviar un mensaje


CCT8 purified MaxPab mouse polyclonal antibody (B02P)

CCT8 purified MaxPab mouse polyclonal antibody (B02P)