GMEB1 monoclonal antibody (M01), clone 2A8
  • GMEB1 monoclonal antibody (M01), clone 2A8

GMEB1 monoclonal antibody (M01), clone 2A8

Ref: AB-H00010691-M01
GMEB1 monoclonal antibody (M01), clone 2A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GMEB1.
Información adicional
Size 100 ug
Gene Name GMEB1
Gene Alias P96PIF|PIF96
Gene Description glucocorticoid modulatory element binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq TAMQDGSTLGNMTTMVSPVELVAMESGLTSAIQAVESTSEDGQTIIEIDPAPDPEAEDTEGKAVILETELRTEEKVVAEMEEHQHQVHNVEIVVLED
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GMEB1 (NP_077808, 467 a.a. ~ 563 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10691
Clone Number 2A8
Iso type IgG2a Kappa

Enviar un mensaje


GMEB1 monoclonal antibody (M01), clone 2A8

GMEB1 monoclonal antibody (M01), clone 2A8