CSPG5 polyclonal antibody (A01)
  • CSPG5 polyclonal antibody (A01)

CSPG5 polyclonal antibody (A01)

Ref: AB-H00010675-A01
CSPG5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CSPG5.
Información adicional
Size 50 uL
Gene Name CSPG5
Gene Alias MGC44034|NGC
Gene Description chondroitin sulfate proteoglycan 5 (neuroglycan C)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KKLYLLKTENTKLRRTNKFRTPSELHNDNFSLSTIAEGSHPNDDPSAPHKIQEVLKSCLKEEESFNIQNSMSPKLEGGKGDQADLDVNCLQNNLT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CSPG5 (NP_006565, 445 a.a. ~ 539 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10675

Enviar un mensaje


CSPG5 polyclonal antibody (A01)

CSPG5 polyclonal antibody (A01)