GNA13 monoclonal antibody (M02), clone 6D8-E4
  • GNA13 monoclonal antibody (M02), clone 6D8-E4

GNA13 monoclonal antibody (M02), clone 6D8-E4

Ref: AB-H00010672-M02
GNA13 monoclonal antibody (M02), clone 6D8-E4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant GNA13.
Información adicional
Size 100 ug
Gene Name GNA13
Gene Alias G13|MGC46138
Gene Description guanine nucleotide binding protein (G protein), alpha 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGDKMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFLDNLDKLGEPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEFDQV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GNA13 (AAH36756, 1 a.a. ~ 377 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10672
Clone Number 6D8-E4
Iso type IgG1 Kappa

Enviar un mensaje


GNA13 monoclonal antibody (M02), clone 6D8-E4

GNA13 monoclonal antibody (M02), clone 6D8-E4