FARS2 monoclonal antibody (M03), clone 3F1
  • FARS2 monoclonal antibody (M03), clone 3F1

FARS2 monoclonal antibody (M03), clone 3F1

Ref: AB-H00010667-M03
FARS2 monoclonal antibody (M03), clone 3F1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FARS2.
Información adicional
Size 100 ug
Gene Name FARS2
Gene Alias FARS1|HSPC320|PheRS|dJ520B18.2
Gene Description phenylalanyl-tRNA synthetase 2, mitochondrial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KVKFQPLSKYPAVINDISFWLPSENYAENDFYDLVRTIGGDLVEKVDLIDKFVHPKTHKTSHCYRITYRHMERTLSQREVRHIHQALQEAAVQLLGVEGRF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FARS2 (NP_006558.1, 351 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10667
Clone Number 3F1
Iso type IgG2a Kappa

Enviar un mensaje


FARS2 monoclonal antibody (M03), clone 3F1

FARS2 monoclonal antibody (M03), clone 3F1