CUGBP1 purified MaxPab rabbit polyclonal antibody (D01P)
  • CUGBP1 purified MaxPab rabbit polyclonal antibody (D01P)

CUGBP1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010658-D01P
CUGBP1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CUGBP1 protein.
Información adicional
Size 100 ug
Gene Name CUGBP1
Gene Alias BRUNOL2|CUG-BP|CUGBP|NAB50|hNab50
Gene Description CUG triplet repeat, RNA binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CUGBP1 (NP_941989.1, 1 a.a. ~ 483 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10658

Enviar un mensaje


CUGBP1 purified MaxPab rabbit polyclonal antibody (D01P)

CUGBP1 purified MaxPab rabbit polyclonal antibody (D01P)