KHDRBS1 purified MaxPab mouse polyclonal antibody (B01P)
  • KHDRBS1 purified MaxPab mouse polyclonal antibody (B01P)

KHDRBS1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010657-B01P
KHDRBS1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human KHDRBS1 protein.
Información adicional
Size 50 ug
Gene Name KHDRBS1
Gene Alias FLJ34027|Sam68|p62
Gene Description KH domain containing, RNA binding, signal transduction associated 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGSRGGARASPATQPPPLLPPSATGPDATVGGPAPTPLLPPSATASVKMEPENKYLPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KHDRBS1 (AAH10132.1, 1 a.a. ~ 381 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10657

Enviar un mensaje


KHDRBS1 purified MaxPab mouse polyclonal antibody (B01P)

KHDRBS1 purified MaxPab mouse polyclonal antibody (B01P)