CAMKK2 purified MaxPab rabbit polyclonal antibody (D01P)
  • CAMKK2 purified MaxPab rabbit polyclonal antibody (D01P)

CAMKK2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010645-D01P
CAMKK2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CAMKK2 protein.
Información adicional
Size 100 ug
Gene Name CAMKK2
Gene Alias CAMKK|CAMKKB|KIAA0787|MGC15254
Gene Description calcium/calmodulin-dependent protein kinase kinase 2, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CAMKK2 (NP_705719.2, 1 a.a. ~ 541 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10645

Enviar un mensaje


CAMKK2 purified MaxPab rabbit polyclonal antibody (D01P)

CAMKK2 purified MaxPab rabbit polyclonal antibody (D01P)