IGF2BP2 monoclonal antibody (M01), clone 4C6
  • IGF2BP2 monoclonal antibody (M01), clone 4C6

IGF2BP2 monoclonal antibody (M01), clone 4C6

Ref: AB-H00010644-M01
IGF2BP2 monoclonal antibody (M01), clone 4C6

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant IGF2BP2.
Información adicional
Size 100 ug
Gene Name IGF2BP2
Gene Alias IMP-2|IMP2|VICKZ2|p62
Gene Description insulin-like growth factor 2 mRNA binding protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq MNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IGF2BP2 (AAH21290, 1 a.a. ~ 598 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10644
Clone Number 4C6
Iso type IgG2b Kappa

Enviar un mensaje


IGF2BP2 monoclonal antibody (M01), clone 4C6

IGF2BP2 monoclonal antibody (M01), clone 4C6