IMP-2 purified MaxPab mouse polyclonal antibody (B01P)
  • IMP-2 purified MaxPab mouse polyclonal antibody (B01P)

IMP-2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010644-B01P
IMP-2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IMP-2 protein.
Información adicional
Size 50 ug
Gene Name IGF2BP2
Gene Alias IMP-2|IMP2|VICKZ2|p62
Gene Description insulin-like growth factor 2 mRNA binding protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IMP-2 (AAH21290.1, 1 a.a. ~ 598 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10644

Enviar un mensaje


IMP-2 purified MaxPab mouse polyclonal antibody (B01P)

IMP-2 purified MaxPab mouse polyclonal antibody (B01P)