IMP-2 polyclonal antibody (A01)
  • IMP-2 polyclonal antibody (A01)

IMP-2 polyclonal antibody (A01)

Ref: AB-H00010644-A01
IMP-2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IMP-2.
Información adicional
Size 50 uL
Gene Name IGF2BP2
Gene Alias IMP-2|IMP2|VICKZ2|p62
Gene Description insulin-like growth factor 2 mRNA binding protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IMP-2 (NP_006539, 65 a.a. ~ 169 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10644

Enviar un mensaje


IMP-2 polyclonal antibody (A01)

IMP-2 polyclonal antibody (A01)