EXOC5 purified MaxPab mouse polyclonal antibody (B01P)
  • EXOC5 purified MaxPab mouse polyclonal antibody (B01P)

EXOC5 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010640-B01P
EXOC5 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human EXOC5 protein.
Información adicional
Size 50 ug
Gene Name EXOC5
Gene Alias DKFZp666H126|HSEC10|PRO1912|SEC10|SEC10L1|SEC10P
Gene Description exocyst complex component 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MATTAELFEEPFVADEYIERLVWRTPGGGSRGGPEAFDPKRLLEEFVNHIQELQIMDERIQRKVEKLEQQCQKEAKEFAKKVQELQKSNQVAFQHFQELDEHISYVATKVCHLGDQLEGVNTPRQRAVEAQKLMKYFNEFLDGELKSDVFTNSEKIKEAADIIQKLHLIAQELPFDRFSEVKSKIASKYHDLECQLIQEFTSAQRRGEISRMREVAAVLLHFKGYSHCVDVYIKQCQEGAYLRNDIFEDAGILCQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EXOC5 (NP_006535.1, 1 a.a. ~ 708 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10640

Enviar un mensaje


EXOC5 purified MaxPab mouse polyclonal antibody (B01P)

EXOC5 purified MaxPab mouse polyclonal antibody (B01P)