TRIM16 monoclonal antibody (M01A), clone 5F4
  • TRIM16 monoclonal antibody (M01A), clone 5F4

TRIM16 monoclonal antibody (M01A), clone 5F4

Ref: AB-H00010626-M01A
TRIM16 monoclonal antibody (M01A), clone 5F4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRIM16.
Información adicional
Size 200 uL
Gene Name TRIM16
Gene Alias EBBP
Gene Description tripartite motif-containing 16
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq LDAARRDKEAELQCTQLDLERKLKLNENAISRLQANQKSVLVSVSEVKAVAEMQFGELLAAVRKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELERMA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIM16 (NP_006461, 165 a.a. ~ 273 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 10626
Clone Number 5F4
Iso type IgG2a Kappa

Enviar un mensaje


TRIM16 monoclonal antibody (M01A), clone 5F4

TRIM16 monoclonal antibody (M01A), clone 5F4