TRIM16 purified MaxPab rabbit polyclonal antibody (D01P)
  • TRIM16 purified MaxPab rabbit polyclonal antibody (D01P)

TRIM16 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010626-D01P
TRIM16 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TRIM16 protein.
Información adicional
Size 100 ug
Gene Name TRIM16
Gene Alias EBBP
Gene Description tripartite motif-containing 16
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MAELDLMAPGPLPRATAQPPAPLSPDSGSPSPDSGSASPVEEEDVGSSEKLGRETEEQDSDSAEQGDPAGEGKEVLCDFCLDDTRRVKAVKSCLTCMVNYCEEHLQPHQVNIKLQSHLLTEPVKDHNWRYCPAHHSPLSAFCCPDQQCICQDCCQEHSGHTIVSLDAARRDKEAELQCTQLDLERKLKLNENAISRLQANQKSVLVSVSEVKAVAEMQFGELLAAVRKAQANVMLFLEEKEQAALSQANGIKAHL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRIM16 (NP_006461.3, 1 a.a. ~ 564 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10626

Enviar un mensaje


TRIM16 purified MaxPab rabbit polyclonal antibody (D01P)

TRIM16 purified MaxPab rabbit polyclonal antibody (D01P)