IVNS1ABP monoclonal antibody (M01), clone 4B1
  • IVNS1ABP monoclonal antibody (M01), clone 4B1

IVNS1ABP monoclonal antibody (M01), clone 4B1

Ref: AB-H00010625-M01
IVNS1ABP monoclonal antibody (M01), clone 4B1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IVNS1ABP.
Información adicional
Size 100 ug
Gene Name IVNS1ABP
Gene Alias DKFZp686K06216|FLARA3|FLJ10069|FLJ10411|FLJ10962|FLJ35593|FLJ36593|HSPC068|KIAA0850|ND1|NS-1|NS1-BP|NS1BP
Gene Description influenza virus NS1A binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLKADKE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IVNS1ABP (NP_006460.2, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10625
Clone Number 4B1
Iso type IgG1 Kappa

Enviar un mensaje


IVNS1ABP monoclonal antibody (M01), clone 4B1

IVNS1ABP monoclonal antibody (M01), clone 4B1