POLR3C purified MaxPab rabbit polyclonal antibody (D01P)
  • POLR3C purified MaxPab rabbit polyclonal antibody (D01P)

POLR3C purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010623-D01P
POLR3C purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human POLR3C protein.
Información adicional
Size 100 ug
Gene Name POLR3C
Gene Alias RPC3|RPC62
Gene Description polymerase (RNA) III (DNA directed) polypeptide C (62kD)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTGTSLDQVKKALCVLVQHNLVSYQVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSAVVKKVADRLTETMEDGKTMDYAEVSNTFVRLADTHFVQRCPSVPTTENSDPGPPPPAPTLVINEKDMYLVPKLSLIGKGKRRRSSDEDAAGEPKAKRPKYTTDNKEPIPDDGIYWQANLDRFHQHFRDQAIVSAV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen POLR3C (NP_006459.3, 1 a.a. ~ 534 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10623

Enviar un mensaje


POLR3C purified MaxPab rabbit polyclonal antibody (D01P)

POLR3C purified MaxPab rabbit polyclonal antibody (D01P)