Ver mas grande
POLR3C purified MaxPab mouse polyclonal antibody (B03P)
AB-H00010623-B03P
Producto nuevo
POLR3C purified MaxPab mouse polyclonal antibody (B03P)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | POLR3C |
| Gene Alias | RPC3|RPC62 |
| Gene Description | polymerase (RNA) III (DNA directed) polypeptide C (62kD) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Ce,WB-Tr,IF |
| Immunogen Prot. Seq | MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTGTSLDQVKKALCVLVQHNLVSYQVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSAVVKKVADRLTETMEDGKTMDYAEVSNTFVRLADTHFVQRCPSVPTTENSDPGPPPPAPTLVINEKDMYLVPKLSLIGKGKRRRSSDEDAAGEPKAKRPKYTTDNKEPIPDDGIYWQANLDRFHQHFRDQAIVSAV |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | POLR3C (NP_006459.3, 1 a.a. ~ 534 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 10623 |
Más información
Mouse polyclonal antibody raised against a full-length human POLR3C protein.