STAMBP purified MaxPab mouse polyclonal antibody (B01P)
  • STAMBP purified MaxPab mouse polyclonal antibody (B01P)

STAMBP purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010617-B01P
STAMBP purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human STAMBP protein.
Información adicional
Size 50 ug
Gene Name STAMBP
Gene Alias AMSH|MGC126516|MGC126518
Gene Description STAM binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen STAMBP (NP_006454.1, 1 a.a. ~ 424 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10617

Enviar un mensaje


STAMBP purified MaxPab mouse polyclonal antibody (B01P)

STAMBP purified MaxPab mouse polyclonal antibody (B01P)