RBCK1 purified MaxPab rabbit polyclonal antibody (D01P)
  • RBCK1 purified MaxPab rabbit polyclonal antibody (D01P)

RBCK1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010616-D01P
RBCK1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RBCK1 protein.
Información adicional
Size 100 ug
Gene Name RBCK1
Gene Alias C20orf18|HOIL1|RBCK2|RNF54|UBCE7IP3|XAP3|XAP4|ZRANB4
Gene Description RanBP-type and C3HC4-type zinc finger containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGTATPDGREDQERLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARLAGEEEALRQYQQGVPAGHHPQQPGGGGLLPLH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RBCK1 (ENSP00000290048, 1 a.a. ~ 230 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10616

Enviar un mensaje


RBCK1 purified MaxPab rabbit polyclonal antibody (D01P)

RBCK1 purified MaxPab rabbit polyclonal antibody (D01P)