SPAG5 monoclonal antibody (M01A), clone 5F9
  • SPAG5 monoclonal antibody (M01A), clone 5F9

SPAG5 monoclonal antibody (M01A), clone 5F9

Ref: AB-H00010615-M01A
SPAG5 monoclonal antibody (M01A), clone 5F9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SPAG5.
Información adicional
Size 200 uL
Gene Name SPAG5
Gene Alias DEEPEST|MAP126|hMAP126
Gene Description sperm associated antigen 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AETETKVLQEALAGQLDSNCQPMATNWIQEKVWLSQEVDKLRVMFLEMKNEKEKLMIKFQSHRNILEENLRRSDKELEKLDDIVQHIYKTLLSIPEVVRGCKELQGLLEF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SPAG5 (AAH00322, 1082 a.a. ~ 1191 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 10615
Clone Number 5F9
Iso type IgG3 Kappa

Enviar un mensaje


SPAG5 monoclonal antibody (M01A), clone 5F9

SPAG5 monoclonal antibody (M01A), clone 5F9