SC65 monoclonal antibody (M01), clone 1E12
  • SC65 monoclonal antibody (M01), clone 1E12

SC65 monoclonal antibody (M01), clone 1E12

Ref: AB-H00010609-M01
SC65 monoclonal antibody (M01), clone 1E12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SC65.
Información adicional
Size 100 ug
Gene Name SC65
Gene Alias NOL55
Gene Description synaptonemal complex protein SC65
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq QCKVDCEANLTPNVGGYFVDKFVATMYHYLQFAYYKLNDVRQAARSAASYMLFDPKDSVMQQNLVYYRFHRARWGLEEEDFQPREEAMLYHNQTAELRELLEFTHMYLQS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SC65 (NP_006446, 270 a.a. ~ 379 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10609
Clone Number 1E12
Iso type IgG2a Kappa

Enviar un mensaje


SC65 monoclonal antibody (M01), clone 1E12

SC65 monoclonal antibody (M01), clone 1E12