SC65 MaxPab rabbit polyclonal antibody (D01)
  • SC65 MaxPab rabbit polyclonal antibody (D01)

SC65 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00010609-D01
SC65 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SC65 protein.
Información adicional
Size 100 uL
Gene Name SC65
Gene Alias NOL55
Gene Description synaptonemal complex protein SC65
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MARVAWGLLWLLLGSAGAQYEKYSFRGFPPEDLMPLAAAYGHALEQYEGESWRESARYLEAALRLHRLLRDSEAFCHANCSGPAPAAKPDPDGGRADEWACELRLFGRVLERAACLRRCKRTLPAFQVPYPPRQLLRDFQSRLPYQYLHYALFKANRLEKAVAAAYTFLQRNPKHELTAKYLNYYQGMLDVADESLTDLEAQPYEAVFLRAVKLYNSGDFRSSTEDMERALSEYLAVFARCLAGCEGAHEQVDFK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SC65 (NP_006446.1, 1 a.a. ~ 437 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 10609

Enviar un mensaje


SC65 MaxPab rabbit polyclonal antibody (D01)

SC65 MaxPab rabbit polyclonal antibody (D01)