PAIP1 monoclonal antibody (M04), clone 2D11
  • PAIP1 monoclonal antibody (M04), clone 2D11

PAIP1 monoclonal antibody (M04), clone 2D11

Ref: AB-H00010605-M04
PAIP1 monoclonal antibody (M04), clone 2D11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PAIP1.
Información adicional
Size 50 ug
Gene Name PAIP1
Gene Alias MGC12360
Gene Description poly(A) binding protein interacting protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq YPTLSEYVQDFLNHLTEQPGSFETEIEQFAETLNGCVTTDDALQELVELIYQQATSIPNFSYMGARLCNYLSHHLTISPQSGNFRQLLLQRCRTEYEVKDQAAKGDEVTR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PAIP1 (NP_001002, 76 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10605
Clone Number 2D11
Iso type IgG3 Kappa

Enviar un mensaje


PAIP1 monoclonal antibody (M04), clone 2D11

PAIP1 monoclonal antibody (M04), clone 2D11