USP16 purified MaxPab mouse polyclonal antibody (B01P)
  • USP16 purified MaxPab mouse polyclonal antibody (B01P)

USP16 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010600-B01P
USP16 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human USP16 protein.
Información adicional
Size 50 ug
Gene Name USP16
Gene Alias UBP-M
Gene Description ubiquitin specific peptidase 16
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MGKKRTKGKTVPIDDSSETLEPVCRHIRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDKAEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRSEPHCLVLSLDNWSVWCYVCDNEVQYCSSNQLGQVVDYVRKHASITTPKPEKDNGNIELENKKLEKESKNEQEREKKENMAKENPPMNSPCQITVKGLSNLGNTCFFNAVMQNLSQTPVLRELLKEVKMSGTIVKIEPPDLALTEPLEINLEPPGP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen USP16 (AAH30777.1, 1 a.a. ~ 822 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10600

Enviar un mensaje


USP16 purified MaxPab mouse polyclonal antibody (B01P)

USP16 purified MaxPab mouse polyclonal antibody (B01P)