SMC2L1 polyclonal antibody (A01)
  • SMC2L1 polyclonal antibody (A01)

SMC2L1 polyclonal antibody (A01)

Ref: AB-H00010592-A01
SMC2L1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SMC2L1.
Información adicional
Size 50 uL
Gene Name SMC2
Gene Alias CAP-E|CAPE|FLJ10093|SMC2L1|hCAP-E
Gene Description structural maintenance of chromosomes 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq CVKGLVASLISVKDTSATTALELVAGERLYNVVVDTEVTGKKLLERGELKRRYTIIPLNKISARCIAPETLRVAQNLVGPDNVHVALSLVEYKPELQKAMEFVFGTTFVC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMC2L1 (NP_006435, 521 a.a. ~ 630 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10592

Enviar un mensaje


SMC2L1 polyclonal antibody (A01)

SMC2L1 polyclonal antibody (A01)