SCGN purified MaxPab rabbit polyclonal antibody (D01P)
  • SCGN purified MaxPab rabbit polyclonal antibody (D01P)

SCGN purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010590-D01P
SCGN purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SCGN protein.
Información adicional
Size 100 ug
Gene Name SCGN
Gene Alias CALBL|DJ501N12.8|SECRET|SEGN|setagin
Gene Description secretagogin, EF-hand calcium binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SCGN (NP_008929.2, 1 a.a. ~ 276 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10590

Enviar un mensaje


SCGN purified MaxPab rabbit polyclonal antibody (D01P)

SCGN purified MaxPab rabbit polyclonal antibody (D01P)