MTHFS monoclonal antibody (M01), clone 2C12
  • MTHFS monoclonal antibody (M01), clone 2C12

MTHFS monoclonal antibody (M01), clone 2C12

Ref: AB-H00010588-M01
MTHFS monoclonal antibody (M01), clone 2C12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MTHFS.
Información adicional
Size 100 ug
Gene Name MTHFS
Gene Alias FLJ30410|HsT19268
Gene Description 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq LPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MTHFS (NP_006432, 104 a.a. ~ 203 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10588
Clone Number 2C12
Iso type IgG1 Kappa

Enviar un mensaje


MTHFS monoclonal antibody (M01), clone 2C12

MTHFS monoclonal antibody (M01), clone 2C12